DPCstruct | MC946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1EIR3 | 39-160 | ARAKIYGIACRVKYLVDTPENIWGCLDESMLLEASGRYLRAKEVHGLVTACGGADLDVMSRFPLLKHQWEIVESFKTQISQKSRERL… |
| A0A699Y957 | 1-120 | MGSRVRYLVDTPEMIWGCLDTQQHLDAARRFLRAQHVHQLLLDTYSRDQLARFPLLNHQWPLVLKFKQQVEDAALAGLASQSALATP… |
| Q54ZB3 | 221-345 | None |
| A0A2H5SD04 | 119-238 | None |
| A0A821P5B3 | 99-223 | None |
| A0A7S3GI90 | 102-243 | None |
| A0A4W5MI36 | 91-237 | None |
| A0A819YXZ4 | 91-225 | None |
| A0A3P8S7L5 | 98-230 | None |
| A0A4P9VWE8 | 18-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.