DPCstruct | MC9459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 190 ± 16 aa |
| Standard deviation of domain lengths | 16.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674JX97 | 179-349 | TQEEKGPRRPGKPHPLSPEEVERRRQEKLREDGMKLVAMIREAELAGVPPEEVGAALRYSGTELPLPWLRSELPAVLDAVVEQATEQ… |
| A0A401TCK3 | 1-194 | MAVCCPVPGGYWSNGPVLCSQMGEEQLVSPEEVCCALRSSGTEEPLAWLQTELPQMLDSIADLASQKGHTMAQDQVGPVSRDEARLA… |
| A0A3B5M8C5 | 264-460 | None |
| A0A146LFM9 | 828-998 | None |
| S9XQQ4 | 229-424 | None |
| E7F0V6 | 412-620 | None |
| A0A6J2RVA2 | 470-667 | None |
| A0A6P4ZMD1 | 125-306 | None |
| A0A3Q1N9Q8 | 416-585 | None |
| A0A4Z2FPC0 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.