DPCstruct | MC9457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 150 ± 28 aa |
| Standard deviation of domain lengths | 28.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.18 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF05805- PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3S586 | 2-111 | FTSTIFAVIGFLGAGYSFVISAVSINKGPKCLMVNSTWGYPFHNGDYLIDEALWSKCREPENVIPWNLTLFSILLVTGGIQMLLCAF… |
| A0A401T7Q7 | 16-145 | GNDNIYGHCQTRIYGKSRMVLTVVLVSLIGMAGAGYCFNVSLLGLLKGPYCLTDLGWNYPFNSTNGRYLTDLTTWSQCREPSHIVAW… |
| A0A5E4B7S9 | 7-141 | None |
| A0A5E4BA25 | 25-159 | None |
| A0A4W5KHL2 | 5-176 | None |
| A0A3P8VIJ2 | 1-178 | None |
| A0A7N4NVD9 | 19-168 | None |
| A0A6P8S6R5 | 454-613 | None |
| L5JMH5 | 37-201 | None |
| A0A6B0S4L6 | 925-1118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.