DPCstruct | MC9454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 229 ± 24 aa |
| Standard deviation of domain lengths | 23.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5HEB3 | 3-259 | NIELYINNRLCDIRNAENLGIRLNRVLINPVELNTKDAQYSYSVTIPSSATNDAIFGFANVEETKDKFNHDHSALLYVDSILVFDGR… |
| A0A1T5PCU7 | 1-242 | MIGIFVNGRFLDIPPGATTSMERNTPLLLGDTVLGELMLPLTIPPTENNIIALGFITEPGKEKTATDVKVEAQYYEHGIFMYRGTLV… |
| A0A2D7XCL8 | 80-343 | None |
| A0A3D6E9E4 | 1-264 | None |
| A0A6S6T5K5 | 4-225 | None |
| A0A0M3CB09 | 1-262 | None |
| A0A0P0M3D3 | 1-206 | None |
| A0A2D8XMT0 | 15-232 | None |
| A0A4P8LST5 | 3-217 | None |
| A0A2S1LQG6 | 3-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.