DPCstruct | MC9451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3Y3G5 | 1-63 | EEVVVLDGDAPHPDSVEETSNNWDAKKLYYPSREHPNSVEISSGDIRCLQPESLLSSPIMNFY |
| A0A1S3XP48 | 13-92 | QAQSSCTLRHVNDEAVVLVDEEEPDVVEIRQQVHVVESTMATKIYYPSRDDPESVEICYSDMESLAPEAYLSSTIMNFYI |
| A0A0L9TCP7 | 89-172 | None |
| A0A3L6DHP3 | 5-67 | None |
| A0A067GUS6 | 248-342 | None |
| A0A2P2M8P6 | 256-335 | None |
| A0A2K3NN32 | 1-97 | None |
| A0A453FFZ2 | 134-215 | None |
| A0A1Z5R756 | 30-109 | None |
| A0A843VK52 | 4-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.