DPCstruct | MC9450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1101 |
|---|---|
| Mean domain length (aa) | 147 ± 24 aa |
| Standard deviation of domain lengths | 23.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.17 |
| Pfam Score | 75.48 |
| Assigned Pfam label(s) | CL0125- PF01031- CL0063- PF21059- CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1NL76 | 50-203 | MSKLSLRYCNGCYLWHITDFKNKINQMRVNHQLMHYSSGFYTSPNGYKLCIRFNLSPKDPNSIAILIHMMKTDHDNSLDWPFSGRIS… |
| A0A1S3XNT1 | 7-137 | TNKHEWKIFEFSKLGESCFSKEFSVGDYKWKIRIYPNGVCCQRDQSISIYLTSVDAEGFGCRKRVKAKVTLSVKDQISGEHHKKVFS… |
| A0A4Y7L8K2 | 34-199 | None |
| E9FW21 | 12-148 | None |
| A0A7E4VJA9 | 71-220 | None |
| A0A7E4VYX6 | 92-217 | None |
| A0A199VI94 | 10-152 | None |
| A0A7E4W625 | 189-320 | None |
| A0A2B4S9M3 | 497-686 | None |
| A0A2B4SGC9 | 869-1025 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.