DPCstruct | MC945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 58.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7PK53 | 81-193 | GEDSAQFVLSQQKISSWVYFSVILGVVLYVLDVAWIDNSTGFGKVFIDALSAFSGSPEVVMLLLTLIFAVVHSGLASLRDTGEKVIG… |
| A0A699Y8H9 | 1-126 | MKGEDAAQFDIQQQSAQSWTIFFGLLTGVLGLLYLVWIQPGVGLADDYVATIQAATDSNPEATIIAILAVFALFHSGLAALRPAGEK… |
| A0A498JZQ7 | 542-656 | None |
| A0A2U1LRK7 | 219-345 | None |
| I3S2G3 | 68-180 | None |
| A0A150G3T2 | 938-1050 | None |
| A0A7S2UFW7 | 91-233 | None |
| A0A453JLE7 | 1-122 | None |
| A0A6L2MLU7 | 29-141 | None |
| A0A2P6TGT3 | 220-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.