DPCstruct | MC9448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 196 ± 25 aa |
| Standard deviation of domain lengths | 24.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482XQ15 | 137-307 | MFQRCLDDGQYKQALGLALETRRMDIFEKSIRESDDVFGMLCYAFNVAMATLDCRGFRTVVLRHLVQLYRNLAVPDYVNMCQCLIFL… |
| A0A1S3XFB3 | 12-208 | QQAIGMAIECRRLDKIAKAIKESGNVDATLSYCSNISHNFVSRREYRSEVLDLLVKEYEKPKSSPNYLSMCQWLMFLDKPERVASIL… |
| A0A7J0FUN9 | 37-221 | None |
| A0A812S905 | 514-705 | None |
| E9IXI5 | 1-158 | None |
| A0A818HMK7 | 8-210 | None |
| A0A446J957 | 110-335 | None |
| A0A1Y3ECS7 | 595-753 | None |
| B9RWJ0 | 107-343 | None |
| U7Q0J1 | 226-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.