DPCstruct | MC9446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 66.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2Z2M7 | 1-133 | MADTIAMNASDFIITSTYQEIAGSKDKPGQYESHATFTLPGLCRVVSGINIFDPKFNIAAPGADQSVYFPYTEKDKRLTQFHPAIED… |
| A0A287E581 | 34-149 | TDLIAMNHADFIITSTFQEIAGNKDTVGQYESHMAFTMPGMYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESQRRLTSLHPEIEEL… |
| A0A4S4DG96 | 472-560 | None |
| A0A287Y0M9 | 155-232 | None |
| A0A2N9IBN3 | 311-399 | None |
| A0A5N6Q4D6 | 819-906 | None |
| A0A6V7PIM1 | 475-562 | None |
| A0A426ZZH8 | 224-321 | None |
| A0A1D6FU36 | 110-210 | None |
| A0A0E0P766 | 522-609 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.