DPCstruct | MC9443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 15.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376X459 | 1-102 | MTKEEIETLQEENRRLKQQAADRDARDAQVRQEQLHKDNVAFAEKLVAEGRLAPRASSVVVALLDAVAGGDKPVEFAEGESRTPLAT… |
| A0A1W0CZ47 | 1-155 | MTPEQKAALEAENAQLKQKLAQHEARDKASQADKRHQDNVAFAESLVGKGVLAPKHKEAVVAVLDLATTPAADGKSVEFGDGDDKQP… |
| A0A645JA17 | 2-131 | None |
| A0A4Q8XNP4 | 123-255 | None |
| A0A109BYP9 | 81-219 | None |
| A0A2D6XIA5 | 400-560 | None |
| K9RR04 | 96-251 | None |
| A0A7C1RXU6 | 183-318 | None |
| A0A072TDP3 | 22-152 | None |
| A0A1G4UVF9 | 149-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.