DPCstruct | MC944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 173 ± 14 aa |
| Standard deviation of domain lengths | 14.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7AKT3 | 2-147 | ILDFLDEIGIKTKTKSLGNTFLPGIEINRGVLLYDPENLLYPGDLLHEAGHIALMTEEERETIVGNVKEYRSPGQDDEMGVMLWSYA… |
| A0A431LPD9 | 1-185 | MSTSQELTLVTGFLTVIGLSWRWHAGAHGFCPGIDIVDGVLLIAPDARASAALHEAGHLATLPGEFRPYAQRNVSGVQRLICEHVDF… |
| A0A1H7DS16 | 94-269 | None |
| A0A812MT30 | 582-762 | None |
| A0A127V9L7 | 229-386 | None |
| A0A327RTQ1 | 44-205 | None |
| A0A5M6CR80 | 4-165 | None |
| A0A285U2Q0 | 1-189 | None |
| A3UJG0 | 1-186 | None |
| A0A1Y6C3A5 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.