DPCstruct | MC9439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 272 ± 61 aa |
| Standard deviation of domain lengths | 60.59 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 96.19 |
| Assigned Pfam label(s) | PF00953- PF10555- CL0036- PF04356 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832JYP7 | 6-247 | TPLNVFALLLTWGYALIGLADDALKVVFRRPLGLYARQKLGGQLFLGLVAGLLAVSYLHRGSEIITPVLKCSWNLGWFYPLFAALVL… |
| A0A2H0Y5H9 | 21-306 | RDLARAHSLVDVPTRAKPGIHTQLTPLLGGAAVYATFVALIFGAYFFLDIFDQSTILPKHLFGLAMGGALLMIGGYLDDRFRLPPKK… |
| M9LPV8 | 558-884 | None |
| R6Y0N7 | 2-184 | None |
| A0A4Q5KYT4 | 56-375 | None |
| A0A519LRX9 | 2-183 | None |
| F4PZF7 | 848-1124 | None |
| A0A832M6C8 | 143-455 | None |
| A0A164XYB3 | 72-379 | None |
| A0A3S4IBH9 | 2-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.