DPCstruct | MC9437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6NGJ8 | 2-79 | STEAGAAESRIYALATQHGIVAERLPFDDWADHVARLSDAEVPSDPVDDLVVTLRRKGIITDREATELLSDYFSERNA |
| A0A2E9BKM2 | 30-100 | VEAFVRNLAHELGVRYTRTPADQWADTVTRLAGDEVRSGDVQDLLIALKRAGKLSTQDMATLLINYLREQK |
| A0A2Z3R108 | 4-82 | None |
| A0A242MRC6 | 104-182 | None |
| A0A081BF25 | 55-129 | None |
| A0A2M8VR13 | 89-166 | None |
| A0A4Q5RA32 | 1-84 | None |
| A0A1R1W230 | 14-93 | None |
| A0A257DTM9 | 3-68 | None |
| A0A0Q4N324 | 21-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.