DPCstruct | MC9435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K4RH19 | 6-100 | DVLDQLALRCQVVLPHLNERQRRLMLAQEARLLGHGGVRAVARVAGVSESTVRNGVFELEAGGDPLPDGCVRRPGGGRKPAEQQDPS… |
| T1C1U4 | 5-101 | RQYKWWIKAISGADEVQARRFAAAIALELGHGGVSRVVELTGMSHLTIDKGIKELKNTEKLEVPKRLRSPGGGRKRIEDKDPGIIAD… |
| A0A1V1NVL3 | 100-177 | None |
| A0A1F9N4S6 | 20-100 | None |
| A0A1S5RMS6 | 1-105 | None |
| A0A1E3X2F4 | 170-251 | None |
| F8B4Q3 | 9-100 | None |
| A0A7W7V3H5 | 1-107 | None |
| A0A3D1GZQ6 | 16-101 | None |
| A0A7C7QYJ6 | 58-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.