DPCstruct | MC9434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5VAQ8 | 218-278 | LDAGVAATMGPVSEPYLLAFPGADEFFPLLLTGKLTLAEVYWKTCPLVSWKMLMIGDPLYT |
| A0A2E7CWZ2 | 5-66 | LKFGAAGSSGTVTEPYAISAKFPSPFIHVHYSAGGCLAEAFYQSVSGPYQLLIVGDPLCQPW |
| A0A1F9PFX5 | 295-363 | None |
| A0A2E4IYX0 | 77-141 | None |
| A0A7X7T9C2 | 374-433 | None |
| A0A388PJP9 | 2-60 | None |
| A0A821L8J2 | 90-155 | None |
| A0A0B0EHQ8 | 58-137 | None |
| A0A845TY78 | 52-113 | None |
| A0A1G2XIB9 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.