DPCstruct | MC9430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 146 ± 17 aa |
| Standard deviation of domain lengths | 17.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 31.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5BSE9 | 142-304 | LQTTCARIEHLPIQHENFSVFRQGLQKIYEQGQKAMHLAYTHPSPEMFHEWRKRVKYLWYQIEILALLWPNVLANLAEELHTLSEYL… |
| T1BDV0 | 2-122 | RVYSRGRAAQERAQSHRTATNLHELRKQTKFLFHQLEALEPLQPDLITRLAKRSHRLADLLGDDHNLTVLRTRVTHSPLERHDRVRL… |
| A0A838STT8 | 27-186 | None |
| W9TAQ0 | 1-159 | None |
| A0A1F9V473 | 2-118 | None |
| A0A3B8X1B5 | 13-151 | None |
| A0A2L0WE61 | 14-140 | None |
| A0A1Q3NFB4 | 281-413 | None |
| A0A838PML6 | 141-300 | None |
| A0A1M3BNY8 | 350-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.