DPCstruct | MC9429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1BDG8 | 1-115 | MPGGATDFDVPAYGRFLQQEPDARQITLDAWYAELAPIESAIHFYLKLLRESATFKDRIAPNGGLEEDLTPLASMSLIRIAVDPGCA… |
| F4GR58 | 23-161 | RDNEWLASLRGRLAVPGGSSQVDMPSYFSWQIKSPDVRMHDLHQWVKPFLPLYKGLALILRVLRDSGDVVDVMARQGAYQEMLGGKV… |
| T1HA00 | 268-419 | None |
| A0A7C5GRR9 | 114-253 | None |
| A0A537D633 | 321-484 | None |
| A0A6S6RUS6 | 2-136 | None |
| W0BFF2 | 56-193 | None |
| A0A7C3D2K5 | 147-286 | None |
| A0A7R9AIB6 | 119-255 | None |
| A0A376ZP61 | 239-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.