DPCstruct | MC9428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 149 ± 20 aa |
| Standard deviation of domain lengths | 20.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 14.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4WYL0 | 7-148 | ITDKTLAILPKRDVHVRTEIIEMEQEIDHTSAPFQIIKENCIHYGANYEGRKKSVQHHLDFHQKTPIPMAVSKGLYAIPTESPHNYD… |
| A0A220U2T2 | 9-156 | TINSNTMALLPAKNIEYDTIVIEQSRRLFVRKTPLELIKLACLAEFCTYEGIRCAVMHHTGWQKKVPIPINKNKSIYAFPTHAPTHF… |
| K9EXQ4 | 52-210 | None |
| B9DN36 | 165-303 | None |
| A0A0R1YT20 | 43-189 | None |
| A0A5S5AQ77 | 10-173 | None |
| A0A7X9CQ34 | 44-200 | None |
| A0A3A9JUW0 | 10-164 | None |
| A0A2U1K5H0 | 35-190 | None |
| A0A7M2QRP7 | 92-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.