DPCstruct | MC9427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415T314 | 7-127 | VNRLKELGSIASLSSSDKAEIENLYVLVLDKKFIRTSCSDCYHDAVIEMSVYLNKNGKMKEKSEYGLKNGVLLQMGFGSSEMYTNAN… |
| A0A1V5IXL3 | 1-137 | MTIEEYRSQYAGISSAQVRGLIADTANAFRADTEALYEKYFKAKLNKNCPDCWFDAFLALMRGDLAQMKKRAERSFELRAGALLVAP… |
| A0A3D6EB93 | 2-121 | None |
| A0A6G7C713 | 1-118 | None |
| F8X554 | 1-128 | None |
| C7M967 | 3-151 | None |
| A0A495JA18 | 10-127 | None |
| A0A0F9PAC1 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.