DPCstruct | MC9423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 574 ± 89 aa |
| Standard deviation of domain lengths | 88.72 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.24 |
| Pfam Score | 80.06 |
| Assigned Pfam label(s) | PF16595- PF18541- CL0693- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A154TKR6 | 2-426 | TQRPALSGDAVQKMLGHCAFEPTEPKAAKNTYTAERFVWLTKLNNLRILEQGSERPLTDTERATLMDEPYRKSKLTYAQARKLLDLD… |
| T0UXW1 | 2-615 | TSFDLYLPEEKVLPKHSLLYETFTVYNELTKVRFIAEGMRDYQFLDSKQKKDIVRLYFEDKRKVTDKDIIDYLHAIDGYDRIELKGI… |
| A0A4V6L3I5 | 18-543 | None |
| A0A6P4L7E9 | 7-516 | None |
| A0A389M5Z5 | 178-763 | None |
| A0A2Z4I808 | 185-939 | None |
| A0A522UD61 | 12-496 | None |
| A0A1H7I2G4 | 6-568 | None |
| A0A0X8KN88 | 380-968 | None |
| H1D477 | 2-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.