DPCstruct | MC9422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 112 ± 19 aa |
| Standard deviation of domain lengths | 18.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02618 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A829RAD9 | 2-70 | KKYTLRIAKGDPSSKAGEVLESEGIIKSAKDFDKFLRKNDYEKYVRDGKYKLSSDMSYEKIAKILAHKN |
| T0U0R9 | 3-119 | LILSLAGFFGYRYVSQAVGAKDANSTKFISVEIPKNSGSSYIGQLLESAGVIKSGKVFNYYTKFKNVSNLKSGYYNLQASMTMDEII… |
| A0A4Q9VVF2 | 83-215 | None |
| A0A3A4VHT2 | 246-341 | None |
| A0A7T5RK43 | 215-319 | None |
| A0A7V7B1B3 | 29-135 | None |
| A0A1T4MK81 | 5-128 | None |
| A0A3A4ZJ74 | 2-130 | None |
| A0A1H9BR89 | 225-314 | None |
| A0A373PW60 | 125-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.