DPCstruct | MC9421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 169 ± 30 aa |
| Standard deviation of domain lengths | 29.82 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5CGQ1 | 96-270 | IYDGYFKDEQVKDRDLSDWEGDWQSVYPYLKDGSLDPVMEKKAEEGDKSAKEYKEYYTTGYKTDIEHIGIHDGEVTFKKADSEAKGQ… |
| T0TYS6 | 40-200 | WSGDWQSVYPYLQDGTLDQVFEYKSLMNKDKTAQEYKDYYTKGYQTDVSKISIDGKKMTMTFTKTDGSSVTHTYRYDGYKVLTYASG… |
| A0A1Y1XR36 | 372-542 | None |
| A0A5U9VRW7 | 8-149 | None |
| A0A0Q1CJJ7 | 22-160 | None |
| C6L976 | 58-243 | None |
| H0UJL3 | 23-196 | None |
| A0A1Y1V0W9 | 149-310 | None |
| H7EKI3 | 127-341 | None |
| A0A3S9HAN5 | 128-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.