DPCstruct | MC942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 238 ± 44 aa |
| Standard deviation of domain lengths | 43.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5YQR1 | 48-311 | YQVIKHTQLYELSPRQTDQYLQVLHQLEPDLRERIGMIAEKNIGQPYDIYLLGEAPFEPYDAQPLFELSKSDCVVFAEHTYAMGLSD… |
| A0A1I0ZIA6 | 9-227 | ETPYVEKTLELPGAEKLVINLTGLDCTTFVETVITLTRLAKESEFTFEAFEKELAYIRYRDGINEGYPSRLHYFSDWIFENQEKGIL… |
| A0A7C2Y1W7 | 38-266 | None |
| A0A2T6CM87 | 10-246 | None |
| A0A843T5W3 | 214-486 | None |
| F8CGD5 | 46-308 | None |
| R5IE98 | 342-596 | None |
| A0A2M7R5X4 | 77-307 | None |
| A0A1H8EVM3 | 175-453 | None |
| A0A7C7VD43 | 95-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.