DPCstruct | MC9416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1960 |
|---|---|
| Mean domain length (aa) | 194 ± 41 aa |
| Standard deviation of domain lengths | 40.70 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.26 |
| Pfam Score | 96.74 |
| Assigned Pfam label(s) | CL0322- CL0123- PF00140- PF20239- PF00239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9LJU5 | 9-223 | LCKLAQAGDKQAVSLLIEANLPFVRKVANQIVGNPVRQEHLSACGVGFDDLVQAGSIGLWRAIDGYRQFEEIQFLTYAAPAVKRSMS… |
| A0A7Y3I3K1 | 9-170 | RRVYRLATLLTGTPLVATRVITAVVDAQPDLRNLDDAHIDRLTVLRAREVRGGGMIVDPRVPVPVAQALADLPGQAREAWVLGHVYR… |
| A0A1R0KFR0 | 4-187 | None |
| A0A1Q6L432 | 4-178 | None |
| R6RPN2 | 4-152 | None |
| A0A7C5ITN9 | 3-135 | None |
| B9XHE2 | 7-198 | None |
| A0A7Y2NEN1 | 30-243 | None |
| B9XI24 | 11-200 | None |
| A0A5C4MBC6 | 6-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.