DPCstruct | MC9413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A290PVQ7 | 1-71 | MSDLKKVLVACRNSSGEADIFSCTVEVTEGQYDLGEHYDLAEAMAIAEGYEAPFVCFDQSEQKNIAKHVQE |
| A0A482J2M5 | 1-77 | MSNAQKHPVKVLVACLDSAWNPSIHSCTVEVTHAEELLGQHLELAKADAVASGFEGTMIALDSEAMPSTKLREIADW |
| W6QX25 | 138-219 | None |
| A0A1D7Z8S0 | 48-124 | None |
| A2SN63 | 91-165 | None |
| A0A1Q3Y6T1 | 2-75 | None |
| A0A1Q3XD09 | 2-83 | None |
| A0A7C4UGX3 | 1-78 | None |
| A0A354T703 | 1-66 | None |
| A0A0Q4NHG2 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.