DPCstruct | MC9412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 285 ± 19 aa |
| Standard deviation of domain lengths | 19.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9CJ72 | 264-539 | YATMLTSAKRAIDKHEDPEIRGQAFKELVAVTGSSILFAGLRGFPLYGAFRLVYDTLFAGDEEDDFDTVVRKHVGEGWFKGAITAAT… |
| A0A2M9PPB4 | 49-373 | YSKANKPQWARGAVGGTLFTFKTYSVSYLELMQRMWKQGGPEGKRAVGWALAMLLLMGGAGGVPFMEDAEDLIDGVGQMMGYNVSAK… |
| A0A0F9QJ87 | 980-1239 | None |
| A0A2R3PZP4 | 21-300 | None |
| A0A7V3DEL2 | 434-704 | None |
| A0A0F2J681 | 4-271 | None |
| A0A7G5EIC8 | 4-304 | None |
| A0A509KW86 | 422-728 | None |
| A0A2G3JYE7 | 177-449 | None |
| A0A349NYG5 | 762-1047 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.