DPCstruct | MC9410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Standard deviation of domain lengths | 15.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074YJ27 | 4-148 | TLDKVLLHGYCWGNAFWYGSRGLCRVVDPLMVIGWFRPPVEQHLSPTDLELYNVRTDGWGLISLAAALLVLSRAYSLGHVNRSYSKA… |
| A2Q991 | 1-173 | MDVFYAYTYSTAGWLSLQSIALIIVPEMMTTMLEQESRQPSSIETYLSRCLGMSLLTMAILTVMLTGSIPLTASITDPVTTDDSDPK… |
| A0A0F4YM74 | 1-172 | None |
| A0A2H3E8M3 | 18-174 | None |
| Q5B1P3 | 1-171 | None |
| A0A1Z5SP44 | 1-165 | None |
| A0A1Z5STF1 | 463-644 | None |
| A0A178F7D4 | 1-131 | None |
| C1GW53 | 1-169 | None |
| A0A4T0NIC4 | 4-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.