DPCstruct | MC941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A382FE03 | 101-194 | LQSLVDQKSIAKSDIRSWQAIGVIFGDILVKQHRLKWVFYEDEDGSSKALQWKETANFVFPITLFSRRVQFKQDIVMTDLYEELSGV… |
| A0A2S5KNF5 | 7-101 | LQTIIDSTQIPVTSTQELQSLGIVFGKVFVNETPDYDWWVIEDEYGKDACVRYKETTLLIFPQTMLSKRIEDGEHVDVPDFFQVLKQ… |
| A0A2E3DCH8 | 88-179 | None |
| A0A147FA08 | 27-120 | None |
| A0A5C6A1H6 | 67-146 | None |
| A0A354T6J9 | 2-95 | None |
| A0A0Q4P138 | 1-91 | None |
| A0A7Y6Q112 | 45-139 | None |
| A0A2A9CWK7 | 4-105 | None |
| A0A4Q6BQ21 | 76-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.