DPCstruct | MC9408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 213 ± 33 aa |
| Standard deviation of domain lengths | 32.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2VA69 | 127-326 | VDAPAEGGGGGSDTTTSGGSSGGGGGGGGGGSVLGTTTASTQACDAYITTFMRQGQQNDPEQVKRMQGILKDFEGADVEETGEYDAK… |
| A0A136JPU5 | 94-268 | LSVGLVPEGQMLNYSNIVPNCEPYLNTYLRQGYDNNSDEVIKLQEFLKKYVSSEVVTTGIFDDKTRIAVENFQQQYKEDILTPWNMT… |
| A0A847Y6A9 | 30-230 | None |
| A0A2H0UDX2 | 281-483 | None |
| A0A1G2P3E9 | 148-361 | None |
| A0A3A4YUR3 | 223-435 | None |
| A0A358I2M9 | 239-428 | None |
| A0A1F6EF95 | 121-337 | None |
| A0A0G1KAL5 | 539-746 | None |
| A0A847ED60 | 12-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.