DPCstruct | MC9407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 117 ± 8 aa |
| Standard deviation of domain lengths | 7.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07784 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P7AI37 | 4-113 | ELIFQSVHTVVVIFEGLGIAAMALGFLTAALFAIRALVKGRGGAAAFGTLRRMIGASILLGLEILVAADLIRTISAPTLEEAVTLGL… |
| A0A7L4PMG8 | 2-115 | FVIVVEYIAWAIGLIGIIVIVYGSLVSSIKFLRIEKKRMNGLISLKDTDILRLTLGTYLLLGLEFLIAADIIRTILKPSLEEVAILG… |
| A0A2W5PZS7 | 17-128 | None |
| A0A6M1Z025 | 9-127 | None |
| A0A7W1YQY6 | 48-174 | None |
| A0A853JIE3 | 10-122 | None |
| A0A542I1S3 | 2-125 | None |
| A0A3B8K7E8 | 32-141 | None |
| A0A350T3W7 | 22-133 | None |
| A0A3B9PAE9 | 47-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.