DPCstruct | MC9406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 51 ± 4 aa |
| Standard deviation of domain lengths | 3.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6H5T9 | 38-83 | KISCPNCGFMFSLTYGRTIACRGCPQATRNCPKARCAKCDHEFYLQ |
| A0A7K4DAX3 | 3-55 | TWKNTSNDIVRCPKCNFTFSKQYSRVVSCQSCPMATASCTMVKCPRCQEEFYP |
| A0A497K6R8 | 1-54 | None |
| A0A126QTZ8 | 39-85 | None |
| A0A842LVZ4 | 2-48 | None |
| A0A832X2X5 | 32-78 | None |
| A0A7C1CAG3 | 4-57 | None |
| A0A662GZ08 | 1-60 | None |
| A0A151BAW5 | 1-51 | None |
| A0A256ZKG6 | 8-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.