DPCstruct | MC9405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5IJ54 | 14-107 | AQALQDTADRPGQCVVPWGVCPEHGATLKASGNRTSCMDVACFNSWEYDRLDAPCPEPATHTVQVDGASGGYAVCDGHALTARAHIT… |
| A0A154MVI6 | 9-121 | NKATHDLADYIGEIARTAEYLTRVRVSRDPHLCDVPWGICPDHGVTLRSLEDRAWCTATGCGNTWTYDRLHTPCTEPAAAIATDRDG… |
| A0A3E0HPS8 | 113-234 | None |
| A0A2U2Z2B5 | 2-96 | None |
| A0A4V3FIS3 | 225-335 | None |
| A0A4U0RPI0 | 4-93 | None |
| A0A4R4W2X1 | 230-318 | None |
| A0A2N0JJ25 | 21-128 | None |
| A0A1Q4WR74 | 59-170 | None |
| A0A6H9YM67 | 168-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.