DPCstruct | MC9404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S6S054 | 54-162 | VQRLAMVRFLFDQGVGLARRAEPLSAPAVNHFQDSVEMFLRLAADHLKVNLPNNTAFAEFWTKLEPALPGPLPSKNAMDRMNRLRVA… |
| A0A154MPN6 | 9-113 | MNRLVHTKALFERAMRISHEAHPFDADSLLLFHDSVENLLHQAAGFLEVELQKSSTFDSYWKATQEQKNITLSGRGPMKRMNDARVG… |
| A0A0F9AN13 | 44-160 | None |
| A0A7W4I7K4 | 18-136 | None |
| A0A654CJM5 | 1-118 | None |
| A0A2T4E154 | 1-113 | None |
| A0A2H2WYK4 | 1-114 | None |
| A0A852WMR1 | 1-120 | None |
| A0A2S6N1L2 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.