DPCstruct | MC9402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 290 ± 28 aa |
| Standard deviation of domain lengths | 27.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S9RFI0 | 5-296 | LHGEEEPPHTTEIIDHLEAQSNYDRRREQVRRAQKKHRERKENHCRQLEDELYRLYNLITTEEELQNLRSENDILRDIMLRHSIPLS… |
| A0A2P5IA19 | 2-264 | TNNNIFRMFNPQAPKVDRVEKRRAQVRQAQQAYRERKEVYTKALEREVAKSKAREAELLRENERLKDTVQKMAEKLEQLGGGGPDTA… |
| A0A484FWP4 | 184-508 | None |
| A0A428PW54 | 290-599 | None |
| A0A317T1D7 | 59-298 | None |
| A0A0C3CUT7 | 47-360 | None |
| A0A366R834 | 8-305 | None |
| C4JQN0 | 502-836 | None |
| A0A167Y3J6 | 1-261 | None |
| A0A1F5L5B4 | 5-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.