DPCstruct | MC9401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 15.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3TXJ4 | 2-102 | VEPWATEYCTAIAEQRYGDAIYARYNIFGDIKDGMLTLWDCTDEGPYRERNITVYEQIMEDARGYYDGYQVLYQEALDFYSSNSPND… |
| A0A1S9RD22 | 250-382 | IIDMESSLPEQLFLDIPVAEVINKKARIRMVEPWASRYCTAISEKRYGDAIYARYHIDGNAKDGIYTDQRDTGDGPCTLHETSVYDM… |
| A0A0A2IMB6 | 168-292 | None |
| A0A6M7YRC2 | 157-272 | None |
| A0A507QIS6 | 81-200 | None |
| A0A1L7VAV5 | 441-563 | None |
| A0A0J9W890 | 1-128 | None |
| A0A420NA23 | 8-131 | None |
| A0A318YC92 | 14-121 | None |
| K9G134 | 7-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.