DPCstruct | MC9400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 238 ± 33 aa |
| Standard deviation of domain lengths | 33.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5HYR2 | 12-254 | LRQGVANNIQSADLDASVKTRASVAVSLNIKGSAGEGGDVAAPVNKNVALYGPGDIVGIESRAIIKTEPLNWITNFEPNYLCHIEFY… |
| A0A327NTD9 | 1-223 | MASSYTFLPWLRRGLAKKITEPDPLTNAPASTPNASVMVGVKLLADDLEKQTILHQTTLLGPGDIIGIERDAIVKTEPRAGIVNFEP… |
| A0A0T5NXK8 | 1-201 | None |
| A0A4Q5MW36 | 326-518 | None |
| A0A1E3RZX7 | 5-273 | None |
| A0A5B2VM80 | 10-279 | None |
| A0A0M2UXR5 | 14-253 | None |
| A0A1Y5SHL4 | 15-287 | None |
| A0A839V4L4 | 6-208 | None |
| W0RQJ7 | 25-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.