DPCstruct | MC940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 89 ± 4 aa |
| Standard deviation of domain lengths | 3.64 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8ZNN8 | 1-97 | MNDEQLSRTLQSVGQACFVRFFGEFSSNTLSREDIVEKLRAETDYTEGSCISRTGHARSIINAGRAEAALNIIISSDSPRVSEKTRK… |
| A0A0L6U4L4 | 1-87 | MDLIGTLSNVGKSTFVKYYYNFKNESRYVCIISFTEDYTDIAKATRTNHAKRIFREGMSVQALQMIINSSRVDKDTIDLARKILETE |
| A0A0D0RIH5 | 57-145 | None |
| A0A2G2HVV5 | 4-95 | None |
| A0A1I3LUH6 | 213-300 | None |
| A0A1W1UND6 | 68-157 | None |
| A0A6N7AZC6 | 164-250 | None |
| A0A351YXF7 | 40-129 | None |
| A0A810QE34 | 77-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.