DPCstruct | MC94
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8TRZ9 | 158-217 | RHYKGKKKLYIGALFPMSGGWPGGQACLPAAQMALDLVNSRTDILPDYELELIHYDSMCD |
| A0A6H5IS20 | 14-105 | RLLLLWLLLASICWWLPGSEAQKPLLTGARKRDLYIAGLFPYATHVPESIVGRGVMPSVKLAIDHINDNPNVLRNYRLHMWWNDTQV… |
| R7T4L0 | 4-81 | None |
| S4RYK4 | 133-191 | None |
| E2B8S1 | 2-98 | None |
| A0A443RJ96 | 6-81 | None |
| A0A6F9CNN2 | 11-97 | None |
| A0A1A9UIR9 | 40-110 | None |
| A0A3S1BEE9 | 35-105 | None |
| T1EVM1 | 446-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.