DPCstruct | MC9399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9S265 | 12-73 | VFTRALAADDGAAAKSHLAAGRPITYVDDEYPDELVRKWPDGRREFVDVAADGTVHVVWELA |
| A0A5M6I922 | 11-70 | LIQGLTQDDGAAARSHLDAGRPVYSIADDMPPGLLRKDHPDGRAELIRFDRQGDQVVRRL |
| A0A454A6S6 | 99-163 | None |
| A0A7G5IMV4 | 4-60 | None |
| A0A329WID7 | 4-64 | None |
| A0A385SQT2 | 49-129 | None |
| A0A3G8H389 | 9-77 | None |
| A0A3G8H332 | 4-60 | None |
| A0A157Z6J2 | 14-77 | None |
| A0A157Z520 | 11-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.