DPCstruct | MC9395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 25.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04951 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842YYB5 | 17-164 | HTISGSVVRAIRVNGAELPELGLNAAIAGYYNVPVILVSGDTAISRQAGEVLGKDVVTVAVKEACGRLAAKLVPMGEARRMIKAGVK… |
| A0A532UD12 | 198-343 | SGSRIFDIKLNGNSVPEAGFNGAIAGHFGVPVALISGDQTIVAQAKEMLGDIEGVVVKEGIGTIAKTIHPEKAQKLIKEGAIRALKR… |
| A0A7C3PY41 | 12-93 | None |
| A0A5N9HD40 | 1-92 | None |
| A0A059WYF2 | 42-188 | None |
| A0A4Q3KF93 | 113-259 | None |
| A0A7V3VS50 | 9-132 | None |
| A0A178ILY0 | 1-108 | None |
| A0A265QDY8 | 85-235 | None |
| A0A7X6IKC8 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.