DPCstruct | MC9394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 433 ± 49 aa |
| Standard deviation of domain lengths | 49.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D6XGM1 | 60-529 | RIIQRSCFLAVVLLTAMPLTPALVGRPLAILALILWVPAAVASFALLRYDVARLLLTSFDFWFSTFAIAATSVVYCALFHDARAMAL… |
| A0A5D6YL66 | 104-501 | AIAATATALPGEIRALSSTRLDVLRMVFSSYEFWYYLIVNSVVCGLVGAYFNDARAVVAGMFWLGVLNAAVVDAKTVSIQGLIYASA… |
| H3HBM6 | 69-497 | None |
| D0N5I7 | 11-400 | None |
| K3WWK7 | 16-401 | None |
| K3WU21 | 1-364 | None |
| K3WJ54 | 52-505 | None |
| G4ZX38 | 2-379 | None |
| A0A662X8M0 | 29-472 | None |
| A0A0P1A5R4 | 37-511 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.