DPCstruct | MC9392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 337 ± 71 aa |
| Standard deviation of domain lengths | 71.21 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05626 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4M2J9 | 85-450 | DRFLERCRLGVGKTRDEIERSLAAQDVRASERRIAQALGKLVLDACVFEQSEGVEPPALRREVFLRSAAARRAASPEAPFSKEAVLA… |
| D2RFC2 | 31-379 | EKVILTYQRNVGKEYGKVVEILKRLENARNYKKVRGLAKIIERECEFSSKTDLDPLAVRLFLFERGYVTRLGERKKIVEEASKHFGV… |
| A0A1M3NET9 | 41-396 | None |
| A0A2M8B638 | 34-416 | None |
| A0A7W0Y8G5 | 37-290 | None |
| A0A6G8QA99 | 155-535 | None |
| A0A538QW94 | 456-798 | None |
| A0A7V8YDM7 | 18-354 | None |
| A0A7J3TBQ3 | 2-353 | None |
| A0A7W0FZX9 | 1-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.