DPCstruct | MC9391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 164 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285LG14 | 5-155 | SRQAGQLAYRLCQRTGCHVECNYLGPRRDSYGGWRIEWCDGPTEVEMRQHVADLAAPLPAIATADLRYGRGDTDQARAVALLLWLDE… |
| A0A6J4IQ25 | 3-158 | VEIRWDSSSASSRTRGRWAYHLDWSAGPTRAAMRELVDQVLPEVAGDPPALDRSELVYVRTMTPAAVALAMIASVQRGGPALDGHRD… |
| E4N6F6 | 40-202 | None |
| A0A7H0HM06 | 222-367 | None |
| A0A7Y9I369 | 10-187 | None |
| A0A515XY09 | 1-187 | None |
| A0A1T3NJE2 | 1-155 | None |
| A0A4R8H594 | 4-166 | None |
| A0A7H8J0X0 | 9-170 | None |
| A0A561BZZ5 | 10-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.