DPCstruct | MC9389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1408 |
|---|---|
| Mean domain length (aa) | 203 ± 41 aa |
| Standard deviation of domain lengths | 41.49 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.09 |
| Pfam Score | 97.03 |
| Assigned Pfam label(s) | PF10123- CL0373- CL0015- PF03736- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380DWL9 | 2-156 | KQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIEMASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAA… |
| A0A2P5NSP5 | 11-201 | GVRVAWVKRGEALVVSKSRPGFDAASVDSILGLLRSVSDNSFPNLKFLVFDFNHGGAEASCAVDGFEDMAAANAGLIVDTPVITIAW… |
| A0A0S9S3E9 | 35-208 | None |
| A0A832KFV8 | 2-164 | None |
| A0A1B0C5T1 | 933-1142 | None |
| A0A263DPD6 | 12-207 | None |
| K9V0K5 | 24-144 | None |
| A0A7G5LK64 | 2-119 | None |
| A0A2E2DMP8 | 11-211 | None |
| A0A7C5UP24 | 89-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.