DPCstruct | MC9386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 331 |
|---|---|
| Mean domain length (aa) | 303 ± 62 aa |
| Standard deviation of domain lengths | 62.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.32 |
| Pfam Score | 85.90 |
| Assigned Pfam label(s) | CL0063- CL0486- PF11960- CL0713- PF08557 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9RN45 | 73-392 | VIQQHVLLPYIDWAKGIVRVPTDVVMVTHLILYFTTLVPSAFYLYYRFSWWHGVLHWILQLWYCGAFTLMKHQHIHGNGVLSSKYVV… |
| A0A2V9M5J1 | 20-300 | TEIRALHHLHPWANSVVLLYPALWICSMALMESWRNWPVRITGILIIGISIQAMAILMHEALHGNLFRRPMLDRWVGFILAVPAFFS… |
| A0A2H4S8A2 | 493-808 | None |
| A0A7Y9YGZ1 | 29-397 | None |
| F8JGM7 | 12-413 | None |
| A0A6A6L830 | 747-1091 | None |
| A0A1Q9CH64 | 161-629 | None |
| A0A423GL91 | 39-354 | None |
| A0A099P1N6 | 282-602 | None |
| A0A7S4RM21 | 5-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.