DPCstruct | MC9385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0QUW7 | 3-99 | TPAAVRLWRTAAQRRVRSAFNSIANARVEWQKATAEGREAGTEVVNAQLSKGLLVDLDLGELASLPNIKSVAQAKLTKQQVRSLERL… |
| A0A843TTQ5 | 54-179 | MQSAVSFSCHEEHELHVHGSSPCTTPSSASLSPSAARLWRPAAQRNLRNQWSKLLSSKKLWESGASEGRSNATALVNAYLSRRYMPN… |
| A0A446J6X0 | 2-118 | None |
| A0A2N9HF07 | 10-145 | None |
| A0A2U1PVY2 | 2-120 | None |
| A0A6A2Y5Q3 | 3-117 | None |
| A0A0K9QIV7 | 1-115 | None |
| A0A7C9E370 | 1-132 | None |
| A0A834SP16 | 90-226 | None |
| A0A2P2JLD2 | 42-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.