DPCstruct | MC9384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 12.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843TNT2 | 29-142 | LDMGESQEDGRLDKLINEPTEGNAWHADHIVPVHKGGGECRLENMRTLCVVCHSDVTATQRAEQRTIRKRAKEQLRIVMKELLDNAT… |
| G3GZQ5 | 614-711 | ELFLRVRDAPKSQRKNLLDAAWTAKLPLEQLNEMLRNPAEGHFWQVDHIKPVYEGGGQCSLDNLQTLCTVCHKERTAQQAKERMQAR… |
| A0A1D2A2E4 | 347-469 | None |
| A0A453B670 | 273-389 | None |
| W9RUU8 | 109-245 | None |
| A0A7S0HAK6 | 101-222 | None |
| A0A1S2Y521 | 80-195 | None |
| A0A835E7J6 | 721-828 | None |
| A0A4Y7JBQ5 | 205-325 | None |
| R1FH85 | 5-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.