DPCstruct | MC9380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 4 aa |
| Standard deviation of domain lengths | 3.81 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 53.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U1RRY6 | 9-96 | EQPPASEPVWERPWSVEEIRRSSQNWSLAADAGLLQFLQEFSQQTISRTHEIKKQVDGLIQETKATHCRLHNVFNDFLMLSNTQFIEN |
| A0A663ENR0 | 7-97 | RDAAEPAPVWERPWSLEEIRKGSQSWSLASDAGLLHFLQEFSQQTISRTHEIKKQVDGLISETKAADCRLHNVFNDFLMLSNTQFIE… |
| V3ZL64 | 43-130 | None |
| A0A834F6P6 | 6-103 | None |
| A7RTN2 | 9-105 | None |
| Q552E2 | 13-103 | None |
| A0A023FRV1 | 1-95 | None |
| A0A670YMD8 | 9-93 | None |
| T1JNH9 | 3-90 | None |
| Q91Y25 | 10-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.