DPCstruct | MC938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7VNT5 | 155-239 | TRKNKKTDNPSVDEVRAYIKKQLDDLKAKGVKEYEIVAGNIEKEMKIVRAPKTVCSAMRSCGYDYEEIYSPPKKNGSSLRLKYIL |
| A0A1I4PZQ8 | 300-384 | VESPNSNDFASELHSELESAESEGKAYLDVKSGDLHRTVGSYPSPHHRMHTCCNVMRQMMNEDDEILEQPPKGNGANLVIRYHLP |
| A0A6N4TLP8 | 5-82 | None |
| A0A173KVI6 | 108-196 | None |
| A0A809RCL8 | 11-94 | None |
| A0A662JIR6 | 41-128 | None |
| A0A7K3ZBN9 | 353-435 | None |
| A0A7V0UED8 | 1-96 | None |
| A0A850MDD1 | 1-83 | None |
| A0A1M4MNS1 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.