DPCstruct | MC9379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 18.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.97 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0614- PF10608 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q17PT8 | 2-92 | PVKKQEAHRALELLEDYHSRLSSPQDRALRSAIERVIRIFKSRLFQALLDIQEFYELTLLDDSKSIQQKTAETLLIASKWEQDNAAK… |
| A0A663EL26 | 1-117 | MPVKKKDTDRALVLLEEYCKKLRKPEEQQLKKAIRKVMGIFKSSLFQALLDIQEFYEVTLLNSQKSYEQKIEEANQVAEKWEKTTSA… |
| A0A401RW82 | 1-127 | None |
| A0A267FP46 | 1-139 | None |
| Q17PT7 | 1-118 | None |
| A0A194R0Z5 | 1-130 | None |
| A0A7J6B8N5 | 2-121 | None |
| A0A7J6ACW2 | 1-126 | None |
| A0A493TSH5 | 2-127 | None |
| A0A1I8C1H3 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.